| Known as | Platelet-Derived Growth Factor Subunit B; PDGF Subunit B; PDGF-2; Platelet-Derived GrowthFactor B Chain; Platelet-Derived Growth Factor Beta Polypeptide; Proto-Oncogene c-Sis;Becaplermin; PDGFB; PDGF2; SIS Becaplermin; PDGFB; PDGF2; SIS |
|---|---|
| Derived from | E.coli |
| Purity | Measured by its ability to binding PDGFR2B used funtional ELISA.The ED50 for this binding effect is 5.04ug/ml when PDGFB 1ug/ml in a solid phases.Greater than 95% as determined by reducing SDS-PAGE. |
| Formulation | Lyophilized from a 0.2 μm filtered solution of 4mM HCl. |
| Shipping | The product is shipped at ambient temperature.Upon receipt, store it immediately at the temperature listed below. |
| Storage | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at < -20°C for 15 months |
| Reconstitution | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100μg/ml.Dissolve the lyophilized protein in13X PBS.Please aliquot the reconstituted solution to minimize freeze-t cycles. |
| Endotoxin | Less than 0.1 ng/ug (1 IEU/ug). |
| Amino Acid Sequence | MSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIF KKATVTLEDHLACKCETVAAARPVT |
| Background | Platelet-Derived Growth Factor Subunit B (PDGFB) belongs to the PDGF/VEGF growth factor family. Plateletderived growth factor is a potent mitogen for cells of mesenchymal origin. PDGFB can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGFAB), where the dimers are connected by disulfide bonds. Mutations in this gene are associated with meningioma.Binding of PDGFB to its receptor elicits a variety of cellular responses. In addition, PDGFB is released by platelets upon wounding and plays an important role in stimulating adjacent cells to grow and thereby heals the wound. |
Ser82-Thr190 is expressed.
实验案例