| Known as | Interleukin-21;IL-21; Za11; IL21 |
|---|---|
| Derived from | E.coli |
| Purity | Greater than 95% as determined by reducing SDS-PAGE.Less than 0.1 ng/?g (1 IEU/?g). |
| Formulation | Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2. |
| Shipping | The product is shipped at ambient temperature.Upon receipt, store it immediately at the temperature listed below. |
| Storage | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at < -20°C for 11 months |
| Reconstitution | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100μg/ml.Dissolve the lyophilized protein in 9X PBS.Please aliquot the reconstituted solution to minimize freeze-t cycles. |
| Endotoxin | Less than 0.1 ng/ug (1 IEU/ug). |
| Amino Acid Sequence | MQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTN AGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS |
| Background | IL-21 induces the production of IgG1 and IgG3 in B-cells. IL-21 may promote the transition between innate and adaptive immunity. IL-21 may have a role in proliferation and maturation of natural killer cells in synergy with IL15. IL-21 stimulates interferon gamma production in T-cells and natural killer cells by synergy with IL15 and IL18. Dysregulation of IL-21 has a role in multiple immune-mediated diseases including lupus, psoriasis and chronic inflammatory diseases. |
Gln23-Ser155 is expressed.
实验案例