Known as | Interleukin-18; Iboctadekin; Interferon gamma-inducing factor; IFN-gamma-inducing factor;Interleukin-1 gamma; IL-1 gamma;GIF; IL-18; IL-1g; IL1F4; MGC12320 |
---|---|
Derived from | E.coli |
Purity | Greater than 95% as determined by reducing SDS-PAGE.Less than 0.1 ng/?g (1 IEU/?g). |
Formulation | Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4. |
Shipping | The product is shipped at ambient temperature.Upon receipt, store it immediately at the temperature listed below. |
Storage | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at < -20°C for 10 months |
Reconstitution | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100μg/ml.Dissolve the lyophilized protein in 8X PBS.Please aliquot the reconstituted solution to minimize freeze-t cycles. |
Amino Acid Sequence | YFGKLESKLSVIRNLNDQVLFIDQGNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFKEMN PPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDELGDRSIMFTVQNED |
Background | Interleukin-18 is a secreted protein and it belongs to the IL-1 family. IL-18 is a proinflammatory cytokine and produced by macrophages and other cells. This cytokine can induce the IFN-gamma production of T cells. The combination of this cytokine and IL12 has been shown to inhibit IL-4 dependent IgE and IgG1 production, and enhance IgG2a production of B cells. IL-18 binding protein (IL18BP) can specifically interact with this cytokine, and thus negatively regulate its biological activity. After stimulation with IL-18, natural killer (NK) cells and certain T cells release another important cytokine called interferon-γ (IFN-γ) or type II interferon that plays an important role in activating the macrophages or other cells. |
Tyr37-Asp193 is expressed.
实验案例