| Known as | Interleukin-6; IL-6; B-Cell Stimulatory Factor 2; BSF-2; CTL Differentiation Factor; CDF; Hybridoma Growth Factor; Interferon Beta-2; IFN-Beta-2; IL6; IFNB2 |
|---|---|
| Derived from | E.coli |
| Purity | ED50 is less than 0.1 ng/ml. Specific Activity of 5.0 x 10^7 IU/mg.measured by the dose-dependent stimulation of human TF-1 cells.Greater than 95% as determined by reducing SDS-PAGE.Less than 0.1 ng/?g (1 IEU/?g). |
| Formulation | Lyophilized from a 0.2 μm filtered solution of 20mM HAc-NaAc, 150mM NaCl, pH 5.0. |
| Shipping | The product is shipped at ambient temperature.Upon receipt, store it immediately at the temperature listed below. |
| Storage | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at < -20°C for 6 months |
| Reconstitution | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100μg/ml.Dissolve the lyophilized protein in 4X PBS.Please aliquot the reconstituted solution to minimize freeze-t cycles. |
| Endotoxin | Less than 0.1 ng/ug (1 IEU/ug). |
| Amino Acid Sequence | PVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLV KIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFK EFLQSSLRALRQM |
| Background | Cytokines of the IL6/GCSF/MGF family are glycoproteins of about 170 to 180 amino acid residues that contain four conserved cysteine residues involved in two disulfide bonds. They have a compact, globular fold (similar to other interleukins), stabilized by the 2 disulfide bonds. One half of the structure is dominated by a 4 alpha-helix bundle with a left-handed twist; the helices are anti-parallel, with 2 overhand connections, which fall into a 2- stranded anti-parallel beta-sheet. The fourth alpha helix is important to the biological activity of the molecule. Interleukin-6 (IL-6) is an important proinflammatory and immunoregulatory cytokine expressed by various cells. Interleukin-6 has been shown to inhibit the growth of early stage and to promote the proliferation of advanced stage melanoma cells in vitro. |
Pro29-Met212 is expressed.
实验案例

