| Known as | Interleukin-4; IL-4; B-Cell Stimulatory Factor 1; BSF-1; Binetrakin; Lymphocyte Stimulatory Factor1; Pitrakinra; IL4 |
|---|---|
| Derived from | E.coli |
| Purity | Measured by the dose-dependent stimulation of TF-1 cells.ED50 is less than 2 ng/ml. Specific Activity of 5.0 x 106 IU/mg.Greater than 95% as determined by reducing SDS-PAGE. |
| Formulation | Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4. |
| Shipping | The product is shipped at ambient temperature.Upon receipt, store it immediately at the temperature listed below. |
| Storage | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at < -20°C for 5 months |
| Reconstitution | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100μg/ml.Dissolve the lyophilized protein in 3X PBS.Please aliquot the reconstituted solution to minimize freeze-t cycles. |
| Endotoxin | Less than 0.1 ng/ug (1 IEU/ug). |
| Amino Acid Sequence | MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRL DRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS |
| Background | Interleukin-4 (IL-4) is a pleiotropic cytokine that regulates diverse T and B cell responses including cell proliferation, survival and gene expression. IL-4 is produced by mast cells, T cells, and bone marrow stromal cells. IL-4 regulates the differentiation of naive CD4+ T cells into helper Th2 cells, characterized by their cytokine-secretion profile that includes secretion of IL-4, IL-5, IL-6, IL-10, and IL-13, which favor a humoral immune response. Another dominant function of IL-4 is the regulation of immunoglobulin class switching to the IgG1 and IgE isotypes. Excessive IL-4 production by Th2 cells has been associated with elevated IgE production and allergic response. |
His25-Ser153 is expressed.
实验案例