| Known as | Interleukin-1 beta, Catabolin, IL1F2, IL1B. |
|---|---|
| Derived from | E.coli |
| Purity | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Formulation | Lyophilized from a 0.2 μM filtered solution of 20mM PB,150mM NaCl,pH7.4 |
| Shipping | The product is shipped at ambient temperature.Upon receipt, store it immediately at the temperature listed below. |
| Storage | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at < -20°C for 3 months |
| Reconstitution | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Endotoxin | Less than 0.1 ng/ug (1 IEU/ug). |
| Amino Acid Sequence | MAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQ LESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS* |
| Background | IL1B belongs to the IL-1 family. Interleukin 1 (IL-1) is a family of polypeptide cytokines consisting of two agonists, IL-1 alpha (IL-1F1) and IL-1 beta (IL-1F2) encoded by two distinct genes and perform identical biological functions. IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response. It is identified as endogenous pyrogens, and is reported to stimulate the release of prostaglandin and collagenase from synovial cells. |
实验案例